PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01734.1.g00080.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family BES1
Protein Properties Length: 863aa    MW: 91460.7 Da    PI: 8.9824
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01734.1.g00080.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822206.38.4e-643644912129
                        DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaa 82 
                                   g gr+ptwkErEnnkrRERrRRaiaaki++GLRa Gnyklpk++DnneVlkALcreAGwvvedDGttyrkg+kp+   + a
  Zpz_sc01734.1.g00080.1.am.mk 364 GVGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYKLPKHCDNNEVLKALCREAGWVVEDDGTTYRKGCKPP-PGAGA 443
                                   789************************************************************************.88888 PP

                        DUF822  83 gssasaspesslq.sslkssalaspvesysaspksssfpspssldsis 129
                                         sp+ss+q +s+ ss++aspv+sy+as +sssfpsps+l+++ 
  Zpz_sc01734.1.g00080.1.am.mk 444 ALAGMLSPCSSSQlLSAPSSSFASPVPSYHASAASSSFPSPSRLENNA 491
                                   88999********9*****************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd006852.46E-551185No hitNo description
Gene3DG3DSA:1.10.600.102.4E-702185IPR008949Isoprenoid synthase domain
SuperFamilySSF485761.36E-612185IPR008949Isoprenoid synthase domain
PfamPF003481.7E-414185IPR000092Polyprenyl synthetase
PROSITE patternPS0072301531IPR000092Polyprenyl synthetase
PROSITE patternPS004440156168IPR000092Polyprenyl synthetase
PfamPF056874.8E-61365510IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008299Biological Processisoprenoid biosynthetic process
Sequence ? help Back to Top
Protein Sequence    Length: 863 aa     Download sequence    Send to blast
MPPAAALEMV HTMSLVHDDL PCMDDDDLRR GKPTCHVVYG EPIAVLAGDA LLSLAFRHMA  60
SVDSYPADVD PEKHPARVVR AIGELARCIG SEGLVAGQVV DLEMTGSTGI VPLEKLEYIH  120
LHKTAALLEA SVVIGAIIGG GSDEQIERLR KYARSIGLLF QVVDDILDVT KSSEELGKTA  180
GKDLATLQID ERLSSDRANL DASAAHPSPK AESFNSPDQR GGEGPEGKQP QPGRPPHQPL  240
PPPPQWPSSR GWPSSRDKVT VLPSPPRDRA SSPVLYPSQG TPRSVPGPRE GKLKAAAARH  300
DTSAPLCYSA AGANKTPPSP PRLLSVASVP GASAPSGGEH SARSRGAAEG GEEGIMSSGA  360
AAGGVGRTPT WKERENNKRR ERRRRAIAAK IFTGLRALGN YKLPKHCDNN EVLKALCREA  420
GWVVEDDGTT YRKGCKPPPG AGAALAGMLS PCSSSQLLSA PSSSFASPVP SYHASAASSS  480
FPSPSRLENN APVTPVLPAA ACLQMLPFLR GLPNLPPLRV SNSAPVTPPL SSPTAASRPP  540
PAKVRRPDWD AAVVGDPFRH PFFAVSAPAS PTRARRRPHP DTIPECDESD VSTVHSGRWI  600
SFQMAPTTAP ASPTYNLVNR CGASSSNSME MDGSAPAADR GRGGAEFAFD KGRVVTPWEG  660
ERIHEVAAEE LELTLGVGAN AFRPSDSASS TQGSMKTSNW RSGGVHLELR LLVPIFLCGV  720
LALLIDEHCA AAGPGAGVPS TVPFRYYNEN TSVRAVHGIS GFGRPATVLL SSRPVAERLF  780
ARIAARLGPG GYHTQSGGVP CATPTGRWSF FWFHHSCAVT TPPVRRAVVV GEVVVLLKFG  840
ERSDRLRLRN VMWRQLARRP ASC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5e8l_A4e-82118468247Heterodimeric geranylgeranyl pyrophosphate sy
5e8l_B4e-82118468247Heterodimeric geranylgeranyl pyrophosphate sy
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54743453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36780.11e-22BES1/BZR1 homolog 2